DPCstruct | MC15231
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 363 ± 70 aa |
| Standard deviation of domain lengths | 69.74 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 74.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 17.68 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14828 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2B4RDJ3 | 1-280 | MSGEVLFYDGAELSFSEEVSTDCKDPGEINFVASIQNWFNPNNWQQMEVNKQPFTLSPVSILHADNVPCVHDTVVFPQDSSFIVKSV… |
| A0A3P7DGY0 | 297-669 | VKTDAIADVYFKQSQPLGFYNGSNWIVSKNGIQWRPALHVLQIPSSQDTAIIPSDSGTRILLEDFVTVGALVLAGQNISNETFNDSF… |
| A0A2G9UVS3 | 5-305 | None |
| A0A803U1T1 | 15-340 | None |
| A0A7J6ZUU7 | 27-411 | None |
| A0A195BAI5 | 272-633 | None |
| A0A183J6K7 | 45-411 | None |
| A0A6S7GSH8 | 26-448 | None |
| A0A085LY47 | 437-782 | None |
| T1F9Z7 | 1-229 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.