DPCstruct | MC1523
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 130 ± 15 aa |
| Standard deviation of domain lengths | 15.21 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 86.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 23.09 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V9NI35 | 155-290 | ADALGAFVTRPEHARHFQLISAGSRLPKGIVQASPAIVQSVRVTRRAAPDGRVLFDLVGEVTQSCTVERSGSLFEVQGGSTVIVDPE… |
| A0A2G4JR39 | 8-129 | WENRKALGISERAYSEVLSIDAASRIGPDGIALHETVCQYVERLDIFGAEFKSVLGAERPDGMSSRTRLRAYGGGVLVLDQYGQVKY… |
| A0A6A8RG54 | 138-293 | None |
| A0A1L9BNV5 | 54-174 | None |
| A0A259A826 | 116-237 | None |
| A0A4Q9GG13 | 1-134 | None |
| B4WCZ3 | 896-1068 | None |
| A0A857JDX4 | 489-621 | None |
| A0A257XF57 | 3-130 | None |
| A0A7C1DSD9 | 724-835 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.