DPCstruct | MC15229
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 159 ± 33 aa |
| Standard deviation of domain lengths | 33.42 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 79.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 35.01 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0175 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1J7IP49 | 13-131 | SDEYGPVLEATIAENREKLDSGLGDQLFAKYRATENEYGGKYRLILVGALMMRAGAKIKDEDMQHLRDLVPQINCNEGYTLPLMDEG… |
| A0A4Q4ZZ33 | 1-152 | MGRWGHRLFEVDHDIGIALEVIQDFCKGTRSLGWTTTPSKKLNSGLGEQLLQKYRLDEGGRSSFAAGDNHHEVIMFGATMMLVGATI… |
| A0A4Q4YKQ6 | 1-151 | None |
| A0A1L7X5C1 | 1-173 | None |
| A0A1G4B9N8 | 9-122 | None |
| A0A0G2FGA9 | 1-189 | None |
| A0A0G2FEX5 | 1-167 | None |
| A0A517L8D7 | 56-192 | None |
| A0A1Y2U1V3 | 1-191 | None |
| Q2KGR1 | 1-147 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.