DPCstruct | MC15228
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 55 ± 5 aa |
| Standard deviation of domain lengths | 4.64 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 70.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 77.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0461 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5S6CJ30 | 208-268 | MDPNCSCAAGGSCTCAGSCKCKECRCTSCKKSCCSCCPVGCAKCAQGCICKGASDKCSCCA |
| A0A667HK04 | 54-106 | AGGSCTCAGSCTCKECRCTSCKKSCCSCCPVGCAKCAQGCICKGASDKCSCCA |
| A0A2R9BI48 | 1-51 | None |
| A0A3Q1M9T6 | 131-179 | None |
| A0A5F5XDZ2 | 94-147 | None |
| A0A7N5K1G1 | 44-106 | None |
| A0A5F5Q0N5 | 9-59 | None |
| A0A5F8GGT3 | 32-85 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.