DPCstruct | MC15227
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 99 ± 15 aa |
| Standard deviation of domain lengths | 15.07 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 83.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 36.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A284VP65 | 27-102 | VEFIQATHPIVIVDEPQNMETDLRKKAIENLNPLCTLRYSATHINRYNMVYSLDPVKAYDLGLVKQIEVDSIVTEN |
| A0A1W9LAQ5 | 14-115 | GRIKKSCANLMALIRPLVIVDEAHNAKTDLSYDVLNRVRAGCVIEFTATPAVDSNVLHHVSASILKDEAMIKLPIILAEKPSWQEAL… |
| W1U848 | 35-110 | None |
| A0A258HV58 | 102-193 | None |
| A0A3D0US76 | 1-112 | None |
| A0A4V0ZHD2 | 59-174 | None |
| A0A1U7M3Y8 | 98-208 | None |
| A0A2P8XAP1 | 31-139 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.