DPCstruct | MC15225
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 106 ± 17 aa |
| Standard deviation of domain lengths | 16.72 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 81.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 42.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P9HF02 | 5-107 | KPEYKPYHHPAGGWGAAAATAKVLMEQSVITKGSRALLAMNQPGGFKCPSCAFPDADCKKTLEFCENGAKALAHEATKFRVTREFFE… |
| A0A444I7D5 | 2-93 | KEQRPEGLEQYDHPAGGWDALKAVAKTLAHQQIVAQGSMTLLKANQPEGFDCPGCAWPDPKHTSSFEFCENGAKSITWESTAKRSSP… |
| A0A5N7ZT18 | 5-110 | None |
| A0A1H6Y3X4 | 1-111 | None |
| A0A6I1IZ67 | 13-112 | None |
| A0A377BK41 | 1-104 | None |
| M7N8Z2 | 1-84 | None |
| A0A7I8C451 | 1-91 | None |
| A0A090MHB3 | 1-110 | None |
| A0A1S7PD19 | 1-106 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.