DPCstruct | MC15224
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 208 ± 23 aa |
| Standard deviation of domain lengths | 22.60 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 72.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 41.27 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M7BZ64 | 1-232 | MGWAEIGGCMVRGQEMCLGKTRNLCSRRTQLSIHFYITLHSRKPIAMASQRSSRALRVALRQASAPRVQQRTFVSAVNAASRPSVQP… |
| A0A6V7QVM4 | 1-193 | MAAAASSSLALAPSHCKTLKPLAPKTLTITLPLGFVLLLFLLLPNPSPPPLPPFPTLDFETSVFKKEKITLAGHEEYIVRGGRDLFH… |
| A0A4V6WKK9 | 523-741 | None |
| A0A540LRJ3 | 1-214 | None |
| A0A4Y7KQ72 | 1-217 | None |
| A0A0D2MUK3 | 1-172 | None |
| A0A7J9MHQ1 | 1-210 | None |
| A0A438EGA0 | 1-200 | None |
| A0A287GP45 | 90-338 | None |
| G7E0M7 | 1-176 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.