DPCstruct | MC15220
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 97 ± 8 aa |
| Standard deviation of domain lengths | 7.72 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 91.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 26.62 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13108 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I5E2N9 | 9-107 | NIQDKHAEKFISFLILGVLHSLDKELISIEEAEGFIFMPSTCAPLKEIKASDALINIIETGCQLEDVESLRPDKLSECVSEMIEDTL… |
| A0A7Y8EXB7 | 106-203 | EEVVRFLSALAIGLLTSVQRGVMSLEEAEQLLFTPRTYELLMDRGISPDLCNLVMEACELEDVLSLIPSKFNENVLRSIDQFVALLG… |
| A0A372WGM7 | 2-104 | None |
| A0A1B9LQL0 | 5-106 | None |
| A0A4R6CCP3 | 1-98 | None |
| A0A6I5SRP6 | 2-81 | None |
| A0A847VTF1 | 11-98 | None |
| A0A1I3B2Q6 | 4-93 | None |
| A0A2S8GQR0 | 5-98 | None |
| A0A853I423 | 1-99 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.