DPCstruct | MC1522
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 60 ± 1 aa |
| Standard deviation of domain lengths | 0.92 |
| Length coefficient of variation | 0.02 |
| Mean AlphaFold2 pLDDT confidence score | 91.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.97 |
| Mean intra-cluster sequence similarity (%) | 47.96 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09838 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6F8PVB6 | 1-59 | MFETLLAAIALVFIIEGLLPFVFPEVWKKMMAEASALPEGSLRTMGLVSITIGLLLLLI |
| A0A2N1ZIA1 | 1-61 | MWQELGIALCLVLVLEGILPFLYPRHWRGAVLQAARLPDRRLRLIGLASMLLGTALLYLLH |
| A0A3R8WDQ2 | 1-61 | None |
| A0A1J5RM29 | 1-61 | None |
| A0A1N6F1J1 | 6-65 | None |
| A0A496W7I0 | 1-61 | None |
| A0A316FT54 | 2-59 | None |
| A0A7C1TIS1 | 1-60 | None |
| A0A0M1JBN8 | 1-61 | None |
| A0A6B8JSZ4 | 3-62 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.