DPCstruct | MC15216
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 170 ± 12 aa |
| Standard deviation of domain lengths | 12.20 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 89.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 33.89 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08385 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1D1VYE4 | 2-175 | EEEYRYWLNLSSTTNRSVSVILSALSDLVKSYNDIASAALKDVPEILENVDVQLSKLWKDRALIKAAFTEDRARRIFALFDEQCVSV… |
| A0A340WRU4 | 9-163 | QFWIEQAHRGSKQISKERASYFKELFETIAREFYNLDGLSLLEVVDLVETTRDVVDDVWRQTEHDHYPESRMLHLLDIIGGSFGRFV… |
| A0A821W501 | 155-332 | None |
| A0A835L5P4 | 1-161 | None |
| A0A5N5TCR1 | 4-150 | None |
| A0A8B6GVD5 | 152-332 | None |
| A0A815U371 | 147-331 | None |
| A0A813TAA6 | 155-332 | None |
| A0A7M7JWB0 | 99-272 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.