DPCstruct | MC15215
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 200 ± 33 aa |
| Standard deviation of domain lengths | 32.98 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 67.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 32.85 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G1NF74 | 3-160 | SDSAEPNVWLAAEDEYAREVMGPLKARSKSITIERLVDRRPHVVDPMVAAARERGYVNMLSPTAWTLDDTPGPDVSDKETILTLARM… |
| A0A0C9TT79 | 1-185 | MWLTARTVLLLPLLNYFAGKDLREQHTTKREPQRLQFELRHQHAVSPDAHVVFSDVGPAARNLAGGNQTTYSLWTRNTTSFRPPSFS… |
| A0A179IEI6 | 3-169 | None |
| A0A4U0VLY0 | 1-188 | None |
| A0A4Q3MRD1 | 42-225 | None |
| A0A318Y6T5 | 373-609 | None |
| A0A2B7WQA7 | 16-234 | None |
| A0A4Y8DCP5 | 4-245 | None |
| A0A1Z5SZB3 | 7-272 | None |
| A0A077WN48 | 16-232 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.