DPCstruct | MC15212
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 454 ± 40 aa |
| Standard deviation of domain lengths | 40.33 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 72.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 29.35 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0115 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C9TFG4 | 3-382 | GASFLGLALISGSKLVGFLAILRFLSHWWFLKAVENPHMRKLYGDSLRKEAGFVKVIKNVASKNARLLESRAGRHAPEIKRVAKEVK… |
| A0A1E4S5R4 | 414-800 | TGNWLLLRVILGGLLIALQIWTSTSIYSSIGDFGWFYGDFFLPNLSSKTLTKSGIYRYLNDPERLLGVAGIWGAVLITYSPYVFVLA… |
| A0A137P322 | 465-914 | None |
| A0A0C3AJ27 | 608-1109 | None |
| U5HIJ2 | 411-890 | None |
| A0A1E4TZ97 | 281-737 | None |
| R8BEE4 | 427-904 | None |
| A0A3M7MDM7 | 754-1237 | None |
| A0A1S6QCK6 | 484-951 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.