DPCstruct | MC15211
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 197 ± 17 aa |
| Standard deviation of domain lengths | 17.21 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 32.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Z0A181 | 256-435 | DWGALSHTMAAHRAQSLLGLLPKALQTGLTETEPSLEPLKNFDTDLFIEKPDTEARFSIPTLLEAPDRDVALLTLCNNWDQASLRQQ… |
| A0A0C9TEV3 | 1-198 | MASHRAQLLLTLLPTALAFGLQAVEPEVEPLKNLDTDMPVDLPDTEARFFVANVEQLQNENGEEVLDALLTGWVDFDSRQFVPDAEW… |
| A0A2I1E8I0 | 4-181 | None |
| A0A2N0S1B1 | 452-652 | None |
| A0A2I1GKS9 | 200-404 | None |
| A0A067CRK7 | 478-687 | None |
| A0A0D0DC41 | 178-359 | None |
| A0A2N1MEW9 | 51-254 | None |
| A0A0C9T098 | 2-173 | None |
| A0A433D2N3 | 1-235 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.