DPCstruct | MC15210
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 88 ± 10 aa |
| Standard deviation of domain lengths | 9.88 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 93.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 44.80 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0126 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M5BQC4 | 4-97 | GFTETAYNFQKDNYGRGGKSNDPVYISVQDSSRVNNANFVTLPDGQPGQMNMFMWTKTVPPRDGALENDIVIHEYTHGLTNRLTGGG… |
| R8BM05 | 4-87 | DLLYELGFNEAAGNFEVNNNGKGGKANDFVILNAQDGAGTNNADFSTPPDGQMGRMRMYIWTYSTPNRDCAFEAGVIIHEYTHG |
| A0A0L0TD43 | 1-74 | None |
| A0A177WYC6 | 2-86 | None |
| A0A1S8VQ72 | 2-104 | None |
| A0A7W1JAY8 | 1-77 | None |
| A0A832MD61 | 2-98 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.