DPCstruct | MC1521
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 167 ± 30 aa |
| Standard deviation of domain lengths | 29.79 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 84.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 20.73 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04973 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N1ZC00 | 202-360 | NPWCWPIGLIMVLLYAWLFYDWRLYSNLLLQLLFAALQLYGWWQWTRGGERHDGRKVSRLGIAAVAAGLLSGVIGAWLLGYLMATYT… |
| F8A1H3 | 55-229 | LEALAVATSYASTALCIVQRRFNYVFGAVSTALYAALFFRHGLVASAFLNVYLTPQLVYGWVRWRRDDQTRPVTWLVHDKKWIPAYL… |
| D4JCL4 | 200-402 | None |
| A0A143XPZ9 | 198-319 | None |
| A0A382DEW2 | 22-190 | None |
| A0A535A4H1 | 120-290 | None |
| A0A3N4IIY5 | 66-286 | None |
| A0A6N1DTC5 | 35-244 | None |
| A0A0K2RD34 | 3-136 | None |
| A0A8A7J4H2 | 12-177 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.