DPCstruct | MC15209
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 642 ± 144 aa |
| Standard deviation of domain lengths | 144.42 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 79.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 19.78 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0172 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A150Q5Y8 | 107-641 | NPLPFHKNARPAHLAAETVFQLGGAEAFWRFHGLAFANQRALTPESLEAWAAEAGVDRAAFRASFARQQHEPKIDEDLQAGKAVGVT… |
| A0A0C9T0H2 | 18-756 | AHDTSSGDNVEDADKRPSSEEIISCVFDSLPYIDEEAEARARTGEPLSSEEIANLGLKAIQFMMSFSSRPQAGPLYIHQCWDNHHQV… |
| A0A7J8PR30 | 2-664 | None |
| A0A0X3PEF0 | 209-1008 | None |
| Q8BI80 | 10-392 | None |
| A0A3Q0KM82 | 60-868 | None |
| A0A7J9LVZ4 | 28-845 | None |
| A0A5D3DFV5 | 55-647 | None |
| A0A814E416 | 169-784 | None |
| A4I4S1 | 342-1190 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.