DPCstruct | MC15208
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 111 ± 9 aa |
| Standard deviation of domain lengths | 8.88 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 74.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 36.30 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C3KN79 | 1-110 | MTRTRWTVDGPDDAAVLEIEGRRFSTNNEGVPTMCNLVCRTMGGHAHIDYCRSDEEAACMGNDEVQHIMKRLRPNPDRPKDYVTHNL… |
| A0A2D4C594 | 1-108 | MRNTYFLSDDPEIDIGERKYVAGEQGTAEMCNMYCAKMGREHVHYMPCDQGSAKQCVYTGSSEDKRRHCKRVLEPKPEKEMDELLHE… |
| A0A3F2RSC6 | 1-106 | None |
| A0A397VD73 | 1-109 | None |
| A0A2N0P550 | 4-107 | None |
| A0A0C2ZIH3 | 1-125 | None |
| G4U037 | 1-95 | None |
| A0A329S2Q9 | 648-769 | None |
| A0A484E465 | 1-118 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.