DPCstruct | MC15206
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 95 ± 9 aa |
| Standard deviation of domain lengths | 9.05 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 83.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 49.20 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M2PN24 | 16-97 | TAGVNAETHTVRFNNQCGHGTPQLILNGAVVSTGQDYTSNAPISGIAYLQTGDCGFNGEECTMVEMTLINPTTPGGGSSTDI |
| A0A0C9SY27 | 1-83 | MHPSLFLAVAVPLIAAIRANAESHVIKFVNQCGYGSPVLMLDGKNVLIGDEYTSSGPFSGIGYLQTGGCNTNGENCTLLEMTL |
| B8PHB9 | 5-105 | None |
| A0A1B9HSV0 | 63-162 | None |
| A0A1C7LUV9 | 53-152 | None |
| J4IAB3 | 3-98 | None |
| J4GQI0 | 11-118 | None |
| A0A166L4M0 | 13-112 | None |
| A0A165YRV7 | 55-144 | None |
| B8PDX9 | 3-106 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.