DPCstruct | MC15204
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 131 ± 12 aa |
| Standard deviation of domain lengths | 11.71 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 78.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 30.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4S4LXH5 | 591-726 | PVDIVQRLQRSNPRVFANLKHQRLSEWRDRTILDRFVWKDAVLARTKKGNQPGGENTRLGILHAYPEVVARIKKMLYDLRDASIPLT… |
| A0A0C9SQG5 | 10-138 | LKRMDPSRFSRITAQVIGTWIDHSGPQPVWRASVLDRAACSNLPRAASATPGILSGHPDIIKMIIDDLKALRTVGVPLDTMCCCGVI… |
| A0A060T017 | 252-396 | None |
| A0A5M3MEM1 | 637-743 | None |
| A0A6A4HD06 | 217-353 | None |
| A0A0D0CE75 | 3-116 | None |
| E2LBL0 | 2-119 | None |
| A0A4Z0A593 | 448-590 | None |
| A0A4Y9ZFH0 | 357-481 | None |
| A0A166JHH7 | 327-456 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.