DPCstruct | MC15203
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 118 ± 10 aa |
| Standard deviation of domain lengths | 10.07 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 30.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A4HY41 | 69-184 | NISATAHALILDLGPLKLLFAFLTHCNLNLYLREQWEKSICVLTKAQCHFSVGLAFEFRLHFLAFISIDLIFQPVWYYSIDPPPFEA… |
| A0A5C3NXD8 | 93-208 | MVLRDVIRTPRTIVLDFGQYGVQVQLLTHTLAQPYTHEQYHDEIMQVSCIDNRRGFRVGFAFEFEEYTLAFLSADLLISPNWFKMCD… |
| A0A2H3BXT9 | 235-348 | None |
| B0DCI2 | 82-193 | None |
| A0A0C3ELB8 | 86-202 | None |
| A0A0C3BWD3 | 1-106 | None |
| A0A166FVM3 | 92-226 | None |
| A0A4Y9Z5F3 | 82-211 | None |
| A0A284QJY6 | 109-219 | None |
| S7QNV1 | 86-213 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.