DPCstruct | MC15202
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 187 ± 21 aa |
| Standard deviation of domain lengths | 21.15 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 18.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V5RUT5 | 35-210 | KDVAFYYPGPFWHSAGWIKNLLLFFDGVGLLVPSYMRGKPFELEPEMAHPLKREGLLHILEPETLVDRDATKQLATALSEVIASGAL… |
| A0A4U8W6U8 | 1-214 | MPDLFYYPKINAPQSVIYQALLYWDRLVTIAPAGPVLELLTPQMRHMHEAGLYLRLPADHWPGATTTIEQALWTLTRLLDRIPADDL… |
| A0A1P8VPY9 | 1-209 | None |
| A0A4V2E6U2 | 11-206 | None |
| A0A661IV24 | 1-163 | None |
| A0A143YCS2 | 7-178 | None |
| A0A1I3R2Q5 | 1-170 | None |
| A0A1R4HL24 | 7-200 | None |
| A0A1H3LI70 | 16-243 | None |
| A0A5J6GEC5 | 9-177 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.