DPCstruct | MC15201
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 59 ± 5 aa |
| Standard deviation of domain lengths | 5.28 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 41.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3S3F6T4 | 1-54 | MARYLVTWEIDYEGEGDPEAAARWAWDILRKPHSTASVFTMIDEDGNETKIDLA |
| A0A4U8W4I3 | 1-68 | MSEYSVTWQIDVTADNPVHAAHAALAVQRDPYSTATVFDITDEHGTTHRIDLHDDPAELTALPTLTTP |
| A0A822JHE3 | 1-58 | None |
| A0A497BHT0 | 1-68 | None |
| A0A193KJJ4 | 1-58 | None |
| A0A0N0AWT1 | 21-84 | None |
| A0A7Z6XDE4 | 9-65 | None |
| A0A1V4WXX7 | 238-290 | None |
| A0A1J4VYI8 | 4-55 | None |
| A0A6M3XLU2 | 92-150 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.