DPCstruct | MC1520
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 108 ± 9 aa |
| Standard deviation of domain lengths | 9.19 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 16.70 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M0BM74 | 1-115 | MWRAISVKAKDGTLLGSLKVEGREVVFVPEGELGFTITTPPFQSFLMERVLDNMRSSDEGRVAAGEIPYDDALSYEVSADGERLRSL… |
| A0A843I331 | 1-90 | MKNKKGEVLAEILYTPPLFKIMVKSKISSKKPAFNALGKLLESEKSISRIEYEIVTDNDDLKEIVIKNVNDDILYNKLKAGIQAILE… |
| A0A0F9RME7 | 2-107 | None |
| X1AIH4 | 21-130 | None |
| A0A662IR30 | 65-181 | None |
| A0A7C2Q6H6 | 1-106 | None |
| A0A662RYJ8 | 59-164 | None |
| A0A538NNY1 | 86-189 | None |
| A0A7C2Q1I2 | 63-180 | None |
| A0A1Q7LPU9 | 165-291 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.