DPCstruct | MC152
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 120 ± 11 aa |
| Standard deviation of domain lengths | 10.78 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.51 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 30.19 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06476 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y6R8B6 | 39-160 | LATTALTLLLAAASVGASAADTQLAGCAAKRESIRSELRQAQEQGLSDKVAGLTRALDEVNAHCRDSTLIERHNKKVLKAQAKVNQT… |
| A0A1B8H2E9 | 12-112 | CEIKKDKITEQIRYAKAHGNTYRVQGLERALQNVETYCTPDSLRNDARSEMNDRKKEVEEQKADLQKAIDKGDKAKIAKRERKLAEA… |
| A0A6F8U9N7 | 2-105 | None |
| W0V8F6 | 13-129 | None |
| E0WV30 | 1-105 | None |
| A0A5C8LSX2 | 48-180 | None |
| A0A448SCN6 | 1-141 | None |
| A0A3D2SST9 | 9-121 | None |
| A0A658G814 | 1-114 | None |
| A0A557NTS1 | 12-144 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.