DPCstruct | MC15198
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 109 ± 14 aa |
| Standard deviation of domain lengths | 14.22 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 82.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 24.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04149 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A840Q644 | 15-126 | WFKSSFSSPSQSCVEVRFDGDLVSVRDSKYRRDPANDLAQEPIITVTADQWGALLDEITGRATPGTNGVLSIEHSPDGTVVLRAIED… |
| A0A2L2JK34 | 9-123 | WFKATRSSSSSSCVEVAFTVEAALIRDSKYLRDPNNDPAQQPIIRVSAEVWPDLLKAVEDRAVAGTAGLPAINYEAAGGASISDGVT… |
| A0A291RW55 | 27-139 | None |
| Q0RQ41 | 1-139 | None |
| A0A4R1FS60 | 11-136 | None |
| A0A6G4XTC9 | 2-95 | None |
| A0A7X0HKT3 | 7-118 | None |
| A0A291RF98 | 1-91 | None |
| A0A5R8PCC1 | 16-130 | None |
| A0A7W8A7Q3 | 4-103 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.