DPCstruct | MC15197
Metacluster Properties and Pfam Annotations
| Number of structural domains | 101 |
|---|---|
| Mean domain length (aa) | 305 ± 52 aa |
| Standard deviation of domain lengths | 51.77 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 82.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.46 |
| Mean intra-cluster sequence similarity (%) | 17.44 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07643 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A819UZ10 | 79-321 | KFNKVDGISFDTESGQVQFSFQPVTLKSGEAMFDSNDVIEVFQRGLTSCFFTLNQPDNNFHAHPFQEMLYYPSSLLYTQYCATLLHT… |
| A0A7S1QVE7 | 42-344 | RNMQESLRAKYEIGWSQELVPGNVSLAGRLGVQLDPQGMCCLAVNEDELTMRLARTNHPGVAVNLDYLSIALKVGLLEGAQPWFSLD… |
| A0A2V7YGQ6 | 78-435 | None |
| A0A353RT18 | 4-373 | None |
| A0A353RWA2 | 38-354 | None |
| A0A496SET7 | 90-377 | None |
| A0A1K1YN35 | 1-245 | None |
| A0A3D1FAB5 | 32-395 | None |
| A0A1G2YEW6 | 373-699 | None |
| A0A1B1ZRH1 | 692-970 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.