DPCstruct | MC15196
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 117 ± 21 aa |
| Standard deviation of domain lengths | 20.93 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 82.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 25.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S0BAH3 | 21-126 | FQGCVSSDVFRSSFYDPKHPHCVRTITIDGTGKSGQLMGTSPRSGHNCDGATDLEWGPLSASFGGGTVVADFTSQGGPSELVGYWNR… |
| A0A7S1QST2 | 6-101 | GKSSEDWVGRYADPKHPGCRREINIALEGVVVSGSDGTPGCLKGERQKNWNLMASWKPGDELLIDFSPKGGPKDLLGKWEGDGIRFP… |
| A0A7S2VSH5 | 2-120 | None |
| A0A812Q3L4 | 1-107 | None |
| A0A7S2UEJ4 | 8-127 | None |
| A0A7S4A8E5 | 29-153 | None |
| A0A7S4RUP2 | 77-219 | None |
| K8F7C0 | 9-117 | None |
| A0A7S2JE58 | 25-128 | None |
| A0A7S0A5H1 | 52-172 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.