DPCstruct | MC15195
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 168 ± 23 aa |
| Standard deviation of domain lengths | 23.05 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 89.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 25.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S1Q8L0 | 32-189 | PFSCSDYAGFCQLQPLVRAVCPFTCGCHDPLSGLLWTSPAQGCPIKCREGRLQHRRGRPCVDMHTVNMSAWGTYWTTLGDFWTADLA… |
| A0A812I8E8 | 168-351 | LVNSAAGALGRAGARGCQELKDKCDDPDGRLLRMICGETCGCLEPFSSPWYKVPAQGCAPACLELGQPKLQNRSCQDMPVDDTWRAF… |
| A0A812MN63 | 612-775 | None |
| A0A812QAZ6 | 332-510 | None |
| A0A812SYM6 | 293-458 | None |
| A0A812XC14 | 212-395 | None |
| A0A812V0X7 | 135-296 | None |
| A0A1Q9ELT7 | 7-160 | None |
| A0A7R9ZVK9 | 139-411 | None |
| A0A1Q9DJN6 | 82-248 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.