DPCstruct | MC15193
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 280 ± 35 aa |
| Standard deviation of domain lengths | 35.29 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 90.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 29.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S1Q540 | 38-322 | KGKNTASAEDFGIPGFNEALNEALLPCVHLDPSGDLEEMKAKVAQKIVKAAQKMGADERLSARGSSTQAKALIEEFVESAMGAVSAG… |
| A0A812SE66 | 1-218 | MEGYLADAVAEAIEPVQHLEKEWEPAKLCKRLREYFKKAAKSLEFKDKGRSWTGLVNDFADSAFSSIFQAIGDRQWLDQVDFIFVLD… |
| A0A813CZX5 | 7-269 | None |
| A0A812U552 | 2-232 | None |
| A0A812UEZ6 | 419-696 | None |
| A0A812TFU2 | 106-455 | None |
| A0A812R551 | 709-985 | None |
| A0A812TX96 | 23-317 | None |
| A0A812Q0B5 | 5-296 | None |
| A0A812SG34 | 54-375 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.