DPCstruct | MC1519
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 153 ± 13 aa |
| Standard deviation of domain lengths | 12.76 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 22.41 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18931 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A352KTI2 | 135-276 | REANLNTYANENVKKASPLRPGSSDYHFEKGDLTYHDTYFGATKFIGEEIVYKSGKVAWGMNYYGFTLNNEISEGLFDAILRPALMS… |
| A0A1F6KFW0 | 18-183 | LKKLSNFIVIANGKTWAADGAEVAPRRPGYKRLQWPYPDEKMTDQDRRDYKGWEDWRLEDEYSGYFRAPGTTTIYYKGVPAWIMSYG… |
| A0A7C4XPY6 | 4-129 | None |
| R5ELR8 | 24-159 | None |
| A0A7T5RFK6 | 6-167 | None |
| A0A359DZ35 | 1-160 | None |
| A0A1F5GVL1 | 9-170 | None |
| A0A522BNF0 | 4-149 | None |
| A0A0G1HWL8 | 10-172 | None |
| A0A0G1C2X7 | 26-189 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.