DPCstruct | MC15188
Metacluster Properties and Pfam Annotations
| Number of structural domains | 70 |
|---|---|
| Mean domain length (aa) | 304 ± 97 aa |
| Standard deviation of domain lengths | 96.95 |
| Length coefficient of variation | 0.32 |
| Mean AlphaFold2 pLDDT confidence score | 77.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 18.55 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A428TWV3 | 13-283 | GSAPALRNHQDVFDIIRLFKARPNTKRSQLTQEYFSKRDKPPPPADQHRAFNLAVRIMSMVKCSADNQPSGLLELGTQPIQWHSNNS… |
| A0A4Q4UJU9 | 6-314 | KRKIERSIWSTTDNPGNESNPRLESYFGYCHREMRQAAVLAGNRVEWFNSILSAFDVLKSNHDKPKRDLGSPSLDLSVMDLGLRLML… |
| A0A2V1CTD9 | 1-137 | None |
| A0A2V1CSU6 | 5-199 | None |
| A0A6A5ZDC0 | 26-312 | None |
| A0A093Y311 | 363-572 | None |
| A0A3D8RJT0 | 37-593 | None |
| A0A0S7EBV5 | 3-311 | None |
| A0A4U0V5C9 | 3-471 | None |
| A0A4Z0YIQ8 | 24-336 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.