DPCstruct | MC15187
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 276 ± 30 aa |
| Standard deviation of domain lengths | 29.50 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 28.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q4TQ41 | 1-305 | MSVPLYWRQFTRDGSPDVDTQADAAFLAAKFTDYFGQWLQEGDNGLARSFDALVMPYWTGSQQSPAQYKVSTFMIADGSFIQAGETP… |
| I4Z4L1 | 32-251 | PPGKLYRLRRGRDAFPNGMDSTEQEVLNDPLATLLLRRGIFPLTMGELDAALAADGTLPHRLSFVVAEGGTIPFNEAPALQRGFRFV… |
| A0A175WG83 | 341-607 | None |
| A0A2Z6RDG1 | 212-450 | None |
| Q2GTT9 | 1-288 | None |
| A0A3N4KAU4 | 1-298 | None |
| A0A3N4IZW5 | 1-265 | None |
| A0A2T6ZI64 | 1-309 | None |
| A0A395M7X6 | 15-335 | None |
| A0A2J6SL18 | 408-680 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.