DPCstruct | MC15185
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 96 ± 13 aa |
| Standard deviation of domain lengths | 13.06 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 88.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 34.49 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0108 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V4PP88 | 1-100 | AALAIHWELGPSYPLIRTLAEGVAQGMKDHIGKGQPLVLVFDADIAKLVGNIIERELLPGAGIISIDGIDLKDFDFVDIGEELPDAK… |
| A0A1V5LNL0 | 3-83 | QCASALARLYREYPDPAHPAIIISANDVGKVLGMELEPLIKPKALAVIDEVNTREGDYIDIGKSYFGGDIVPLTVKSLAFP |
| A0A376J1F9 | 258-339 | None |
| A0A399YMJ9 | 277-380 | None |
| A0A849Q6S2 | 189-298 | None |
| A0A497QCX2 | 123-230 | None |
| A0A536HZR8 | 299-395 | None |
| A0A1V5HI64 | 239-336 | None |
| A0A661D6W6 | 31-124 | None |
| A0A447PCF1 | 1-73 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.