DPCstruct | MC15184
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 246 ± 23 aa |
| Standard deviation of domain lengths | 22.87 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 81.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 30.49 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V5LMW8 | 35-286 | LGRYEGSGRAEITLQGRVNGRTENWIYRLAFPDRAEEHAFIPRLWASRRIGYLLDQIRLHGEERELREEVVDLARRYGIVTPYTAWL… |
| A0A2V5TLU8 | 170-434 | GRYTGKGASAVVLEGTVNGARKKLTYDVNFSGETTEHDFIPRLWATRRVGYLLEEIRLHGENAELKDEVTELARKYSIVTPYTAYLI… |
| A0A7W1C4H6 | 464-703 | None |
| A0A7C2PWU3 | 936-1207 | None |
| A0A533SIK9 | 1-225 | None |
| A0A1V6BUN5 | 1-200 | None |
| A0A0N8WB15 | 2-238 | None |
| A0A2V6P609 | 1-273 | None |
| A0A256YQC8 | 3-233 | None |
| A0A1F8LUY8 | 53-321 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.