DPCstruct | MC15183
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 213 ± 60 aa |
| Standard deviation of domain lengths | 60.43 |
| Length coefficient of variation | 0.28 |
| Mean AlphaFold2 pLDDT confidence score | 84.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 20.84 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A359HGV5 | 264-492 | REINKLIETQADEELFAEATHRELETTLGLMLLPQKFPEDEKIYHEIVQQIAPESDPAHWSVLFSWVFTHNLGKTISETEDFSERSR… |
| A0A1V5L823 | 63-259 | VPRLSALAESFSKMLPLAQEIAARDERSLGILVMWTAVHRLGEVAAPEGFSILSRTWLDEWMLIKVIGESLRGLGCPEGEARRHQLL… |
| A0A7C5S4A1 | 709-939 | None |
| A0A1V5JUQ4 | 162-383 | None |
| A0A350D9Y7 | 4-142 | None |
| A0A1F9DU18 | 341-542 | None |
| A0A1V5VSL2 | 184-400 | None |
| A0A832IMA4 | 530-696 | None |
| A0A1V5D8A6 | 37-227 | None |
| A0A524JH88 | 7-123 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.