DPCstruct | MC15182
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 111 ± 14 aa |
| Standard deviation of domain lengths | 13.90 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 84.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 21.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A650GET1 | 4-112 | PEPTESQVTALDGAVGELIHRDRVAGWLAIQVQPLRDRFLLQNSSCWILITWADGTVELEEDYAPFSLIAEMLGGVVCYEDRGIAYR… |
| A0A1G6WHI5 | 2-105 | LRDLDGAVVGHLAAIVEHFWSPFSPLTWQECVWLLVTWTDGEGEPIIEDYPPWTAVDEVRMGQIEVERMSTGISGTFSVEWLEGSER… |
| A0A4R7NWW0 | 1-107 | None |
| A0A5Q0H9D7 | 2-98 | None |
| A0A0Q9STH9 | 11-133 | None |
| A0A0L6CEX1 | 2-90 | None |
| A0A1S1Q4M1 | 9-125 | None |
| A0A1C6VAQ2 | 105-222 | None |
| A0A330FX88 | 1-144 | None |
| A0A1I3SR61 | 5-108 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.