DPCstruct | MC15181
Metacluster Properties and Pfam Annotations
| Number of structural domains | 97 |
|---|---|
| Mean domain length (aa) | 169 ± 28 aa |
| Standard deviation of domain lengths | 28.29 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 82.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 22.45 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04011 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I2I908 | 57-209 | FRGLTLDKKLDAILDSIDIQWYAWNKNDDERNANIGVFIQELAKLPKHNKAALDSVKMLHQRALELKLTQANLSDSKRIDDYDANTE… |
| A0A7Z9G3J7 | 218-378 | YEERYKNQWAQIDVQLRRRHDLIGPLVETVKGYMAHERETLEAVISARNQCTINLEGVDLANAATMQSLMGAENMLSGALSKLMAVS… |
| A0A285DR51 | 3-121 | None |
| A0A1V4E5L5 | 10-174 | None |
| A0A353PUG8 | 14-143 | None |
| D4YLP6 | 22-241 | None |
| A0A3E0E1W6 | 10-193 | None |
| A0A7C2P613 | 104-302 | None |
| A0A3G2G1M5 | 2-165 | None |
| A0A842J8X0 | 26-137 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.