DPCstruct | MC1518
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 65 ± 15 aa |
| Standard deviation of domain lengths | 14.98 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 82.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.57 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 57.60 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03889 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A484YSG0 | 1-48 | MSRYQHTKGQIKDNAIEALLHDPLFRQRVEKGKKGKGSYLRKDKHAKR |
| C4LF27 | 8-56 | TGYQHQRGAITDNHLQALVTDKLFRSRVEENIKGKGSYRRHAKHRRQDE |
| A0A3R8YNY6 | 1-63 | None |
| A0A1A7PZ74 | 2-55 | None |
| A0A4P5QHV1 | 1-65 | None |
| A0A380B573 | 9-75 | None |
| D4BHT7 | 52-116 | None |
| A0A6L6HB04 | 2-60 | None |
| A0A1G4ZDV1 | 2-63 | None |
| A0A377I7J4 | 18-78 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.