DPCstruct | MC15179
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 274 ± 21 aa |
| Standard deviation of domain lengths | 20.57 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 89.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 24.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| U5QG81 | 943-1224 | REGARPKLPPFAQEATPASVMATLTEPKKSLGPYLQMLERAGIKNPRQQMEQMLKSGKIPFKGVDEDKVRHALKEQFQSKVLSAMTD… |
| A0A7Y5H0H0 | 14-295 | MGLGEKARFPTTASTQDVFNTLTGTKGTGFEPYRQVLVAEGIAKGDDEFLKALEGLKPQGRTIDAVRHEMKELYRSKLLAKMTTPDE… |
| K9WT36 | 728-1000 | None |
| A0A538QGA9 | 310-562 | None |
| A0A538PZY5 | 69-341 | None |
| A0A351L413 | 1-320 | None |
| A0A7Y6AFS0 | 110-378 | None |
| A0A850B6C2 | 775-1038 | None |
| A0A3M1CJS0 | 199-452 | None |
| A0A7W0VSC8 | 888-1183 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.