DPCstruct | MC15177
Metacluster Properties and Pfam Annotations
| Number of structural domains | 279 |
|---|---|
| Mean domain length (aa) | 187 ± 36 aa |
| Standard deviation of domain lengths | 36.35 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 78.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 14.06 |
| Pfam Score | 29.13 |
| Assigned Pfam label(s) | PF11041- PF10076- PF09684- PF06996- PF04865 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5Q0L6B7 | 14-180 | IGAMLPAVFADDDLALRFVAGLDEVVAPILLALDCLHSYFDPALAPADFARWLGTWVGAELDGSEPDDRLRAAVAAAAYLHRVRGTR… |
| A0A7Y5GUQ7 | 8-196 | RLLLPRWLKNEDGELWRLTEALGQVADDARSAVDRVRRLWVTETSSSAGLDAIGAGRACERWDDESDAEYRQRLVALFGVRMRAATP… |
| A0A348HEA2 | 3-193 | None |
| A0A354TCE1 | 8-210 | None |
| A0A843GEX3 | 4-187 | None |
| A0A843FL67 | 453-689 | None |
| A0A6J4LB46 | 59-223 | None |
| A0A0Q4IS19 | 70-249 | None |
| A0A3B0BNM3 | 836-1010 | None |
| A0A7U7FD77 | 2-204 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.