DPCstruct | MC15175
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 118 ± 16 aa |
| Standard deviation of domain lengths | 15.64 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 84.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 44.78 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| N8PWE9 | 143-272 | SDEDRFNELKKYYPEADPKDWHLRQGGQRVQIIKKEPGKPAKLQFGTEIFASEDKSVTALLGASPGASTSPYIMLNLLEKAFPEQTA… |
| A0A0Q5B1M4 | 39-139 | ITPGQRGQVMEPVAQRGGVLQFGTEIVSAADGSIAGLLGASLGASIAVAAMIDVLRTCFPSRCPGCTNELNRLVPSLSQPLLTDRRR… |
| A0A6U2GA86 | 411-540 | None |
| A0A4V0WVE4 | 7-106 | None |
| A0A376VI91 | 101-225 | None |
| A0A376U6G6 | 1-131 | None |
| A0A837Q125 | 6-99 | None |
| A0A2X2RNX8 | 1-104 | None |
| A0A7V9LCK6 | 76-196 | None |
| A0A7X6PMT4 | 1-83 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.