DPCstruct | MC15173
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 119 ± 19 aa |
| Standard deviation of domain lengths | 18.76 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 86.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 24.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M1GTH1 | 1-94 | MIISNSHRFVFVHLHKTAGTAVTDAFVPTLAWNDIFLGSETVGNELEPYFRRRFGLHKHAAAWAIRRVIGDTLWRDYFIFSVVRNPY… |
| A0A6P0YGX7 | 3-103 | SIQKKFLFIHIPKTAGNSIQSVLKHYSEDEILCLNPLQDGVERFEVRNKNFPNIHKHSSLLDYYQVLSPDFFHSRYKFAVIRNPWER… |
| A0A2T2RBT6 | 1-142 | None |
| A7BUW6 | 1-123 | None |
| A0A7Y6XWP1 | 4-143 | None |
| A0A846GB96 | 1-132 | None |
| A0A7V0MGD8 | 1-100 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.