DPCstruct | MC15170
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 150 ± 11 aa |
| Standard deviation of domain lengths | 10.80 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 69.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.35 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 39.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09557 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K8GQ64 | 817-969 | TTTEPSSEPFTEPETTIPVPETVDAIVPLLEERLKVEYERRKVGEVVIRKQVETRMVQVPVRYEKLVIEQVGGEKPLAEVDLSQGAL… |
| A0A846C1J5 | 1-139 | MANENEAQEKIPLLEEKLVVDRSKKKVGEVVVRKEVETKIVEVPIRKEKLIIEQVNIGEETKKLGEIDLTEGEVSVSGNQVDTNDSS… |
| A0A1U7IQ78 | 112-262 | None |
| A0A7Y3TJP1 | 983-1141 | None |
| A0A1Z4JL66 | 1-142 | None |
| A0A2T1C6E4 | 217-351 | None |
| A0A2I8A5B9 | 2-155 | None |
| B1WW69 | 1-131 | None |
| B8HSE0 | 76-222 | None |
| A0A6P0QN46 | 112-279 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.