DPCstruct | MC1517
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 224 ± 23 aa |
| Standard deviation of domain lengths | 22.90 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 81.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.44 |
| Mean intra-cluster sequence similarity (%) | 12.93 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C4LDI7 | 1-262 | MFKHESVAKAEVKGAFRKATQRYDEFYKKLKTGLVKFNSRKNHLRYIEELAQCRGEFMLDHRVCHHHSSWHFQSVMTSLETEFHHLN… |
| A0A5N3S152 | 1-215 | MGINEAKAIWQRLQVEINTAHTEVSNRQRSSIRPDSFYNYLCAHHENTNHFRPIRSEVKIGYYGKVIVAGLLFAENGFLYTETAYYP… |
| A0A7Y0Q4J8 | 6-231 | None |
| A0A4R7KQ61 | 17-240 | None |
| A0A850RL02 | 30-205 | None |
| A0A529F5K9 | 5-269 | None |
| A0A1W2CFK2 | 4-223 | None |
| A0A1R3FME1 | 23-258 | None |
| A0A6L3NLR6 | 3-227 | None |
| A0A842I2Q7 | 15-219 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.