DPCstruct | MC15169
Metacluster Properties and Pfam Annotations
| Number of structural domains | 56 |
|---|---|
| Mean domain length (aa) | 159 ± 27 aa |
| Standard deviation of domain lengths | 26.92 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 73.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.34 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 23.21 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E4GYJ8 | 1-109 | MEWTEARVDQLKRLWDEGLSASQIASRLGDVTRNAVIGKAHRLGLSSRPSPIKRVNHPITAPQERMCQWPIGNPRDPSFRFCGKPAA… |
| A0A2E0QB06 | 2-133 | SKSSWTDERIAVLSKLWGEGKTASQIADILGGVTRNAVIGKAHRLKLNKRASPIQTNRKQKANPQIDLPTNVTTGKGISLLELKERS… |
| A0A5P9KV31 | 36-175 | None |
| A0A2D8G1Y5 | 34-163 | None |
| A0A1M5NCV4 | 2-148 | None |
| A0A7Y4GY20 | 2-167 | None |
| A0A2U1W362 | 9-114 | None |
| A0A2A4VB32 | 1-156 | None |
| A0A2E6QAZ6 | 36-134 | None |
| A0A258KXT4 | 1-160 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.