DPCstruct | MC15164
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 148 ± 12 aa |
| Standard deviation of domain lengths | 11.85 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 83.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 24.84 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V1CZ51 | 4-136 | FTLINGDVVEFSNNIVKPLNCTGSQSRDRFGHIFFIPDAAVPFIDAGKLAKDLFNLSKLALAKYDDSDPQLPVLIKHHAPLSQITGL… |
| A0A365YQL9 | 1-158 | MLLGPDGEVASVTCGEGRERVAFSVRRTERGVLVVPSDAEPLLRRGIVDQQLFDVTELSRPRYRMTAGDGIPVIATYHGERPARLFG… |
| A0A6A7MMC3 | 42-201 | None |
| A0A8B2P3I9 | 1-159 | None |
| A0A2S6GT17 | 41-167 | None |
| A0A2S0UYQ5 | 57-198 | None |
| A0A1U9R1N5 | 41-197 | None |
| A0A5S3RX53 | 19-160 | None |
| A0A7W7S3V4 | 55-211 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.