DPCstruct | MC15163
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 140 ± 12 aa |
| Standard deviation of domain lengths | 11.83 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 30.89 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04238 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y8LQJ7 | 5-139 | DIFPLVSTSFILISGILVAIGWRLIIKGKREAHEKVMVMAAIAATCFFIIYVSRTIFIGNTMFNGPESLKMVYLIFLLFHIVLATVA… |
| I0IM96 | 12-171 | WWDLTVTSETIVFSFLAVGGYFAKKHKGTRHHNTMLLSSVLVAAWFLMYIAQQYIVGIVGFGGPDFVKFLIYYPVIIFHSLVSTAAL… |
| U3A380 | 46-197 | None |
| A0A2D6HH22 | 283-421 | None |
| A0A5Q3L686 | 4-159 | None |
| A0A2G4F9U7 | 2-146 | None |
| A0A2E8B223 | 41-178 | None |
| A0A2E5AM86 | 295-444 | None |
| A0A2V7WIB7 | 4-136 | None |
| A0A523HQ93 | 1-151 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.