DPCstruct | MC1516
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 144 ± 15 aa |
| Standard deviation of domain lengths | 15.03 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 29.30 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F9NQZ6 | 11-141 | KGVLQEWAGLSEVMTTPIVYHGGGWADTLSNHIKQTVLEQRLEKVLNGGWDMATDAEVVCYLSTASLEQPLGSDWTDIYLYEAATLM… |
| A0A1F8QX38 | 1-159 | MNTTAEKEVSDLVGCLTDPVIVFPGGWGDSVPEWLKSVIPLERMIVLMESKDGREPTASDAEACAYLMTVSLSQPIDANWTNIYLYL… |
| A0A7C7QNT8 | 73-239 | None |
| A0A512RPR0 | 59-201 | None |
| A0A512RFL2 | 1-149 | None |
| A0A7J2KVW7 | 1-122 | None |
| A0A6M3M2X8 | 28-181 | None |
| X0ZVZ2 | 2-123 | None |
| A0A1N6KBF5 | 30-177 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.