DPCstruct | MC15152
Metacluster Properties and Pfam Annotations
| Number of structural domains | 55 |
|---|---|
| Mean domain length (aa) | 129 ± 19 aa |
| Standard deviation of domain lengths | 18.63 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 91.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 34.09 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2W5Y259 | 74-211 | LGAMRRISGCVADHGYPDRACTPGAVDPRVTQRNLAGTICQRGYTRGVRPPLRLTEPIKRERLAAYGFAGQPLRQFELDHLVALEIG… |
| A0A1I6LVK7 | 104-239 | GRHAGGDVGSVPNLSLTPGAIRTVSLSEICSAADDDDDLDPVLPASIQHAVFQEYGIAAAGMEKNYQIDYLVNPQLGGTDDIRNLWP… |
| A0A5N0V478 | 88-230 | None |
| A0A178X6K1 | 6-98 | None |
| A0A2W6A390 | 5-117 | None |
| A0A3D5DRM8 | 23-149 | None |
| A0A6I3BSB4 | 241-376 | None |
| A0A2M7W123 | 47-182 | None |
| A0A387HS80 | 186-304 | None |
| A0A1Q7HNK7 | 1-79 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.