DPCstruct | MC15150
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 178 ± 11 aa |
| Standard deviation of domain lengths | 10.81 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 92.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 30.54 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18928 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R7LS90 | 39-218 | NNSSKILFKDLDKDKKNMLTENRKIASDYNKTLYNQWKKPIDNLETIIEMSQECAEMYYKSFIGDAEKEKNLLFHSLRTIHARALLT… |
| A0A627WYL5 | 1-187 | MEYSQAQTDTYLSSIKASMPKIIEENKLSNSSFLNNHLIHWAEPLNLLELLVSECINIGSKYSLERKPDKEPSYATHIGLLVRLHGK… |
| A0A2E0LAK5 | 110-290 | None |
| A0A3D5DWP5 | 1-180 | None |
| A0A0F9SIQ6 | 184-370 | None |
| A0A2U3Q8S6 | 37-205 | None |
| A0A7T7YZ11 | 338-522 | None |
| A0A554MTZ9 | 40-222 | None |
| A0A6L9KWF7 | 96-277 | None |
| A0A1V4UZT4 | 55-202 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.